PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr019908.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 200aa    MW: 23129.2 Da    PI: 9.9792
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr019908.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding651.5e-201562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd++l+++++ +G+++Wk+Ia + g++R++k+c++rw +yl
      Pbr019908.1 15 RGSWTAEEDQKLAQVIEIHGPRRWKSIATKAGLKRCGKSCRLRWMNYL 62
                     89********************************************97 PP

2Myb_DNA-binding50.83.9e-1668113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ + +E++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l
      Pbr019908.1  68 RGNISDQEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 113
                      78999*****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.0751066IPR017930Myb domain
SMARTSM007178.4E-171464IPR001005SANT/Myb domain
SuperFamilySSF466892.35E-2914109IPR009057Homeodomain-like
PfamPF002493.1E-191562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-251669IPR009057Homeodomain-like
CDDcd001673.78E-121762No hitNo description
SMARTSM007171.9E-1567115IPR001005SANT/Myb domain
PROSITE profilePS5129420.43367117IPR017930Myb domain
PfamPF002491.6E-1468113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-2570118IPR009057Homeodomain-like
CDDcd001674.69E-1072113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MVPVSSRSSK KEGNRGSWTA EEDQKLAQVI EIHGPRRWKS IATKAGLKRC GKSCRLRWMN  60
YLRPNIKRGN ISDQEEDLIL RLHKLLGNRW SLIAGRLPGR TDNEIKNYWN SHLSKKMKQN  120
RAVSKTVQGS TEQKNIKAMD VNALTIERQD AFKHEENFNF GFNGDEFFNC SSSEQGPLNL  180
EWMNTFLEMD ESWFTLHEI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-301211724128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1155111e-47AY115511.1 Gossypioides kirkii myb-like transcription factor 3 (MYB3) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009362719.11e-148PREDICTED: transcription factor MYB114-like
SwissprotQ9SEI04e-53WER_ARATH; Transcription factor WER
TrEMBLM5XVV31e-112M5XVV3_PRUPE; Uncharacterized protein
STRINGPOPTR_0006s23780.12e-87(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF21483288
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14750.12e-54myb domain protein 66